Recombinant Full Length Human SFR1 Protein, GST-tagged

Cat.No. : SFR1-1741HF
Product Overview : Human C10orf78 full-length ORF ( NP_001002759.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 245 amino acids
Description : Enables nuclear receptor coactivator activity. Involved in cellular response to estrogen stimulus; double-strand break repair via homologous recombination; and positive regulation of transcription, DNA-templated. Located in nucleus. Part of Swi5-Sfr1 complex.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 54.7 kDa
AA Sequence : MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SFR1 SWI5-dependent recombination repair 1 [ Homo sapiens ]
Official Symbol SFR1
Synonyms SFR1; SWI5-dependent recombination repair 1; C10orf78, chromosome 10 open reading frame 78 , MEI5 recombination repair protein homolog (S. cerevisiae) , MEIR5; swi5-dependent recombination DNA repair protein 1 homolog; bA373N18.1; FLJ41960; MEI5; meiosis protein 5 homolog; MEI5 recombination repair protein homolog; SWI5-dependent recombination repair protein 1; MEIR5; C10orf78; RP11-373N18.1
Gene ID 119392
mRNA Refseq NM_001002759
Protein Refseq NP_001002759
MIM 616527
UniProt ID Q86XK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFR1 Products

Required fields are marked with *

My Review for All SFR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon