Recombinant Full Length Human SGCB Protein, C-Flag-tagged
Cat.No. : | SGCB-173HFL |
Product Overview : | Recombinant Full Length Human SGCB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITS NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Full Length : | Full L. |
Gene Name | SGCB sarcoglycan beta [ Homo sapiens (human) ] |
Official Symbol | SGCB |
Synonyms | A3b; SGC; LGMD2E; LGMDR4 |
Gene ID | 6443 |
mRNA Refseq | NM_000232.5 |
Protein Refseq | NP_000223.1 |
MIM | 600900 |
UniProt ID | Q16585 |
◆ Recombinant Proteins | ||
SGCB-75H | Recombinant Human SGCB, His-tagged | +Inquiry |
SGCB-15029M | Recombinant Mouse SGCB Protein | +Inquiry |
SGCB-2826C | Recombinant Chicken SGCB | +Inquiry |
SGCB-8096M | Recombinant Mouse SGCB Protein, His (Fc)-Avi-tagged | +Inquiry |
SGCB-76H | Recombinant Human SGCB protein, His&T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCB-1889HCL | Recombinant Human SGCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGCB Products
Required fields are marked with *
My Review for All SGCB Products
Required fields are marked with *
0
Inquiry Basket