Recombinant Full Length Human SH2B3 Protein, C-Flag-tagged
Cat.No. : | SH2B3-812HFL |
Product Overview : | Recombinant Full Length Human SH2B3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the SH2B adaptor family of proteins, which are involved in a range of signaling activities by growth factor and cytokine receptors. The encoded protein is a key negative regulator of cytokine signaling and plays a critical role in hematopoiesis. Mutations in this gene have been associated with susceptibility to celiac disease type 13 and susceptibility to insulin-dependent diabetes mellitus. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63 kDa |
AA Sequence : | MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRAELVSLQFTDL FQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEELAPPRPPGPCSFQHFRR SLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAKKFLPWSLAREPPPEALKEAVLRYSLADEAS MDSGARWQRGRLALRRAPGPDGPDRVLELFDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVK DRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDP ACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFSLPHWDSESLP HWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQHLEHEPVNRARDSDYEMDSS SRSHLRAIDNQYTPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Neurotrophin signaling pathway |
Full Length : | Full L. |
Gene Name | SH2B3 SH2B adaptor protein 3 [ Homo sapiens (human) ] |
Official Symbol | SH2B3 |
Synonyms | LNK; IDDM20 |
Gene ID | 10019 |
mRNA Refseq | NM_005475.3 |
Protein Refseq | NP_005466.1 |
MIM | 605093 |
UniProt ID | Q9UQQ2 |
◆ Recombinant Proteins | ||
SH2B3-15053M | Recombinant Mouse SH2B3 Protein | +Inquiry |
SH2B3-3773H | Recombinant Human SH2B3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SH2B3-812HFL | Recombinant Full Length Human SH2B3 Protein, C-Flag-tagged | +Inquiry |
SH2B3-5510H | Recombinant Human SH2B3 Protein (Thr335-Ser561), N-His tagged | +Inquiry |
SH2B3-5373R | Recombinant Rat SH2B3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH2B3-1880HCL | Recombinant Human SH2B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH2B3 Products
Required fields are marked with *
My Review for All SH2B3 Products
Required fields are marked with *
0
Inquiry Basket