Recombinant Full Length Human SH3KBP1 Protein, C-Flag-tagged
Cat.No. : | SH3KBP1-1656HFL |
Product Overview : | Recombinant Full Length Human SH3KBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72.9 kDa |
AA Sequence : | MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAP EKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVL NGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKV KGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEA QNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQ GAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRR PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGG GGPAPLSSAVPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQ KREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSKTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | SH3KBP1 SH3 domain containing kinase binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | SH3KBP1 |
Synonyms | HSB1; AGMX2; CIN85; GIG10; HSB-1; IMD61; MIG18; CD2BP3 |
Gene ID | 30011 |
mRNA Refseq | NM_031892.3 |
Protein Refseq | NP_114098.1 |
MIM | 300374 |
UniProt ID | Q96B97 |
◆ Recombinant Proteins | ||
SH3KBP1-1330H | Recombinant Human SH3KBP1 Protein, MYC/DDK-tagged | +Inquiry |
SH3KBP1-1656HFL | Recombinant Full Length Human SH3KBP1 Protein, C-Flag-tagged | +Inquiry |
SH3KBP1-2503C | Recombinant Chicken SH3KBP1 | +Inquiry |
SH3KBP1-5840H | Recombinant Human SH3KBP1 Protein (Met1-Lys665), C-His tagged | +Inquiry |
SH3KBP1-2004H | Recombinant Human SH3KBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3KBP1-1600HCL | Recombinant Human SH3KBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3KBP1 Products
Required fields are marked with *
My Review for All SH3KBP1 Products
Required fields are marked with *
0
Inquiry Basket