Recombinant Full Length Human SIAH2 Protein, C-Flag-tagged
Cat.No. : | SIAH2-858HFL |
Product Overview : | Recombinant Full Length Human SIAH2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.4 kDa |
AA Sequence : | MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQ HHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKY ATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATP RSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | SIAH2 siah E3 ubiquitin protein ligase 2 [ Homo sapiens (human) ] |
Official Symbol | SIAH2 |
Synonyms | hSiah2 |
Gene ID | 6478 |
mRNA Refseq | NM_005067.7 |
Protein Refseq | NP_005058.3 |
MIM | 602213 |
UniProt ID | O43255 |
◆ Recombinant Proteins | ||
SIAH2-858HFL | Recombinant Full Length Human SIAH2 Protein, C-Flag-tagged | +Inquiry |
SIAH2-5397R | Recombinant Rat SIAH2 Protein | +Inquiry |
SIAH2-15122M | Recombinant Mouse SIAH2 Protein | +Inquiry |
SIAH2-4017R | Recombinant Rhesus Macaque SIAH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIAH2-7233H | Recombinant Human SIAH2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIAH2-1850HCL | Recombinant Human SIAH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIAH2 Products
Required fields are marked with *
My Review for All SIAH2 Products
Required fields are marked with *
0
Inquiry Basket