Recombinant Full Length Human SIRPB1 Protein, C-Flag-tagged
Cat.No. : | SIRPB1-1499HFL |
Product Overview : | Recombinant Full Length Human SIRPB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | SIRPB1 signal regulatory protein beta 1 [ Homo sapiens (human) ] |
Official Symbol | SIRPB1 |
Synonyms | CD172b; SIRP-BETA-1 |
Gene ID | 10326 |
mRNA Refseq | NM_006065.5 |
Protein Refseq | NP_006056.2 |
MIM | 603889 |
UniProt ID | O00241 |
◆ Recombinant Proteins | ||
SIRPB1-3826H | Recombinant Human SIRPB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SIRPB1-6574H | Recombinant Human SIRPB1 protein, His-Avi-tagged | +Inquiry |
SIRPB1-345H | Recombinant Human SIRPB1 protein, Fc-tagged | +Inquiry |
SIRPB1-241H | Recombinant Human SIRPB1 protein, His-Avi-tagged | +Inquiry |
SIRPB1-230H | Recombinant Human SIRPB1 Protein, Isoform 3, Glu30-Leu371, C-His-Avi tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRPB1-1608HCL | Recombinant Human SIRPB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRPB1 Products
Required fields are marked with *
My Review for All SIRPB1 Products
Required fields are marked with *
0
Inquiry Basket