Recombinant Human SIRT5 protein, His-tagged
| Cat.No. : | SIRT5-2683H |
| Product Overview : | Recombinant Human SIRT5 protein(1-310 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-310 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SIRT5 sirtuin 5 [ Homo sapiens ] |
| Official Symbol | SIRT5 |
| Synonyms | SIRT5; sirtuin 5; sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; sir2-like 5; sirtuin type 5; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; silent mating type information regulation 2, S.cerevisiae, homolog 5; SIR2L5; FLJ36950; |
| mRNA Refseq | NM_001193267 |
| Protein Refseq | NP_001180196 |
| MIM | 604483 |
| UniProt ID | Q9NXA8 |
| Gene ID | 23408 |
| ◆ Recombinant Proteins | ||
| Sirt5-4556M | Recombinant Mouse Sirt5 protein, His&Myc-tagged | +Inquiry |
| SIRT5-15155M | Recombinant Mouse SIRT5 Protein | +Inquiry |
| SIRT5-192H | Recombinant Human SIRT5 Protein, His-tagged | +Inquiry |
| SIRT5-8183M | Recombinant Mouse SIRT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIRT5-720Z | Recombinant Zebrafish SIRT5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT5 Products
Required fields are marked with *
My Review for All SIRT5 Products
Required fields are marked with *



