Recombinant Human SIRT5 protein, His-tagged

Cat.No. : SIRT5-2683H
Product Overview : Recombinant Human SIRT5 protein(1-310 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1-310 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name SIRT5 sirtuin 5 [ Homo sapiens ]
Official Symbol SIRT5
Synonyms SIRT5; sirtuin 5; sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; sir2-like 5; sirtuin type 5; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; silent mating type information regulation 2, S.cerevisiae, homolog 5; SIR2L5; FLJ36950;
mRNA Refseq NM_001193267
Protein Refseq NP_001180196
MIM 604483
UniProt ID Q9NXA8
Gene ID 23408

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SIRT5 Products

Required fields are marked with *

My Review for All SIRT5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon