Recombinant Human SIRT5 protein, His-tagged
Cat.No. : | SIRT5-2683H |
Product Overview : | Recombinant Human SIRT5 protein(1-310 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-310 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SIRT5 sirtuin 5 [ Homo sapiens ] |
Official Symbol | SIRT5 |
Synonyms | SIRT5; sirtuin 5; sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; sir2-like 5; sirtuin type 5; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; silent mating type information regulation 2, S.cerevisiae, homolog 5; SIR2L5; FLJ36950; |
mRNA Refseq | NM_001193267 |
Protein Refseq | NP_001180196 |
MIM | 604483 |
UniProt ID | Q9NXA8 |
Gene ID | 23408 |
◆ Recombinant Proteins | ||
SIRT5-110H | Recombinant Human SIRT5 Protein, GST-tagged | +Inquiry |
SIRT5-2434H | Recombinant human SIRT5, His-tagged | +Inquiry |
SIRT5-4880H | Recombinant Human Sirtuin 5, His-tagged | +Inquiry |
Sirt5-4555M | Recombinant Mouse Sirt5 protein, His&Myc-tagged | +Inquiry |
SIRT5-677H | Recombinant Human SIRT5 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT5 Products
Required fields are marked with *
My Review for All SIRT5 Products
Required fields are marked with *