Recombinant Mouse Sirt5 protein, His&Myc-tagged
| Cat.No. : | Sirt5-4556M |
| Product Overview : | Recombinant Mouse Sirt5 protein(Q8K2C6)(37-310aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 37-310aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34 kDa |
| AA Sequence : | SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Sirt5 sirtuin 5 (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) [ Mus musculus ] |
| Official Symbol | Sirt5 |
| Synonyms | SIRT5; sirtuin 5 (silent mating type information regulation 2 homolog) 5 (S. cerevisiae); NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; AV001953; 0610012J09Rik; 1500032M05Rik; |
| Gene ID | 68346 |
| mRNA Refseq | NM_178848 |
| Protein Refseq | NP_849179 |
| ◆ Recombinant Proteins | ||
| SIRT5-8183M | Recombinant Mouse SIRT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIRT5-4712C | Recombinant Chicken SIRT5 | +Inquiry |
| Sirt5-1380R | Recombinant Rat Sirt5 protein, His-tagged | +Inquiry |
| SIRT5-2683H | Recombinant Human SIRT5 protein, His-tagged | +Inquiry |
| SIRT5-2434H | Recombinant human SIRT5, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sirt5 Products
Required fields are marked with *
My Review for All Sirt5 Products
Required fields are marked with *
