Recombinant Full Length Human SIX2 Protein, C-Flag-tagged
Cat.No. : | SIX2-1630HFL |
Product Overview : | Recombinant Full Length Human SIX2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or eye development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKIL ESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLR EWYAHNPYPSPREKRELTEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNSNSHNPLNGSGKSVLG SSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILN PMSANLVDLGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | SIX2 SIX homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | SIX2 |
Gene ID | 10736 |
mRNA Refseq | NM_016932.5 |
Protein Refseq | NP_058628.3 |
MIM | 604994 |
UniProt ID | Q9NPC8 |
◆ Recombinant Proteins | ||
Six2-5889M | Recombinant Mouse Six2 Protein, Myc/DDK-tagged | +Inquiry |
SIX2-8186M | Recombinant Mouse SIX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIX2-2729H | Recombinant Human SIX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SIX2-1630HFL | Recombinant Full Length Human SIX2 Protein, C-Flag-tagged | +Inquiry |
SIX2-15162M | Recombinant Mouse SIX2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIX2-1824HCL | Recombinant Human SIX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIX2 Products
Required fields are marked with *
My Review for All SIX2 Products
Required fields are marked with *
0
Inquiry Basket