Species : |
Human |
Source : |
In Vitro Cell Free System |
Protein Length : |
424 amino acids |
Description : |
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. |
Form : |
Liquid |
Molecular Mass : |
72.710kDa inclusive of tags |
AA Sequence : |
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSA LEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFV IVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGV IAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHG ILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS VMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPT IGNKKNQEIWGIKCRLTLQKPSCL |
Purity : |
Proprietary Purification |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |