| Species : |
Human |
| Source : |
In Vitro Cell Free System |
| Protein Length : |
500 amino acids |
| Description : |
Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the bile duct, and the kidney with an apical localization (SLC10A2; MIM 601295), and the other being found in the basolateral membranes of hepatocytes (SLC10A1). |
| Form : |
Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : |
38.4 kDa |
| AA Sequence : |
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA |
| Applications : |
Antibody Production |
| Notes : |
Best use within three months from the date of receipt of this protein |
| Storage : |
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |