Recombinant Full Length Human SLC10A1 Protein

Cat.No. : SLC10A1-6826HF
Product Overview : Recombinant Human SLC10A1 Full-Length ORF Protein is produced by Wheat Germ (in vitro) expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 500 amino acids
Description : Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the bile duct, and the kidney with an apical localization (SLC10A2; MIM 601295), and the other being found in the basolateral membranes of hepatocytes (SLC10A1).
Form : Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 38.4 kDa
AA Sequence : MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Applications : Antibody Production
Notes : Best use within three months from the date of receipt of this protein
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC10A1 solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [ Homo sapiens ]
Official Symbol SLC10A1
Synonyms SLC10A1; NTCP;
Gene ID 6554
mRNA Refseq NM_003049
Protein Refseq NP_003040
MIM 182396
UniProt ID Q14973

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC10A1 Products

Required fields are marked with *

My Review for All SLC10A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon