Recombinant Cynomolgus Monkey SLC10A1 Protein, His tagged

• Cat.No.: SLC10A1-921C
• Product Overview: Recombinant Cynomolgus Monkey SLC10A1 Protein with His tag was expressed in E. coli.

Specification

• Species: Monkey
• Source: E.coli
• Tag: His
• Protein Length: 1-349 aa
• Description: The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.
• AASequence: MEAHNASAPFNFTLPPNFGKRPTDLALSIILVFMLFFVMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFQLNNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYLYTRGIYDGDLKDKVPYGRIILSLVPVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAMFRCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
• Molecular Mass: 39.6 kDa
• Purity: ≥ 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS, 0.05% Brij78, 6% Trehalose, pH7.4 The volume before lyophilization is 118μl/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name 2: SLC10A1 solute carrier family 10 member 1 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol 2: SLC10A1
• Synonyms 2: SLC10A1; solute carrier family 10 member 1; Ntcp; sodium/bile acid cotransporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 member a1
• Gene ID 2: 712925
• mRNA Refseq 2: XM_001110268
• Protein Refseq 2: XP_001110268
• UniProt ID 2: G7MYJ1