Recombinant Full Length Human SLC14A1 Protein, C-Flag-tagged
Cat.No. : | SLC14A1-1250HFL |
Product Overview : | Recombinant Full Length Human SLC14A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.3 kDa |
AA Sequence : | MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVV FVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKG DYFWWLLLPVCAMSMTCPIFSSALNSVLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAP NISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEN IYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFL IMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | SLC14A1 solute carrier family 14 member 1 (Kidd blood group) [ Homo sapiens (human) ] |
Official Symbol | SLC14A1 |
Synonyms | JK; UT1; UTE; HUT11; Jk(a); Jk(b); RACH1; RACH2; UT-B1; HUT11A; HsT1341 |
Gene ID | 6563 |
mRNA Refseq | NM_015865.7 |
Protein Refseq | NP_056949.4 |
MIM | 613868 |
UniProt ID | Q13336 |
◆ Recombinant Proteins | ||
SLC14A1-5432R | Recombinant Rat SLC14A1 Protein | +Inquiry |
SLC14A1-12H | Recombinant Human SLC14A1 protein, MYC/DDK-tagged | +Inquiry |
SLC14A1-0835H | Recombinant Human SLC14A1 Full Length Transmembrane protein, His-tagged | +Inquiry |
SLC14A1-8223M | Recombinant Mouse SLC14A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc14a1-029M | Recombinant Mouse Slc14a1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC14A1-1803HCL | Recombinant Human SLC14A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC14A1 Products
Required fields are marked with *
My Review for All SLC14A1 Products
Required fields are marked with *