Recombinant Full Length Human SLC14A1 Protein, C-Flag-tagged
| Cat.No. : | SLC14A1-1250HFL |
| Product Overview : | Recombinant Full Length Human SLC14A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 42.3 kDa |
| AA Sequence : | MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVV FVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKG DYFWWLLLPVCAMSMTCPIFSSALNSVLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAP NISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEN IYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFL IMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | SLC14A1 solute carrier family 14 member 1 (Kidd blood group) [ Homo sapiens (human) ] |
| Official Symbol | SLC14A1 |
| Synonyms | JK; UT1; UTE; HUT11; Jk(a); Jk(b); RACH1; RACH2; UT-B1; HUT11A; HsT1341 |
| Gene ID | 6563 |
| mRNA Refseq | NM_015865.7 |
| Protein Refseq | NP_056949.4 |
| MIM | 613868 |
| UniProt ID | Q13336 |
| ◆ Recombinant Proteins | ||
| SLC14A1-15220M | Recombinant Mouse SLC14A1 Protein | +Inquiry |
| SLC14A1-1250HFL | Recombinant Full Length Human SLC14A1 Protein, C-Flag-tagged | +Inquiry |
| SLC14A1-5432R | Recombinant Rat SLC14A1 Protein | +Inquiry |
| SLC14A1-1924H | Recombinant Human SLC14A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SLC14A1-2021H | Recombinant Human SLC14A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC14A1-1803HCL | Recombinant Human SLC14A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC14A1 Products
Required fields are marked with *
My Review for All SLC14A1 Products
Required fields are marked with *



