Recombinant Full Length Human SLC14A1 Protein, C-Flag-tagged

Cat.No. : SLC14A1-1250HFL
Product Overview : Recombinant Full Length Human SLC14A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 42.3 kDa
AA Sequence : MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVV FVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKG DYFWWLLLPVCAMSMTCPIFSSALNSVLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAP NISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEN IYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFL
IMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Full Length : Full L.
Gene Name SLC14A1 solute carrier family 14 member 1 (Kidd blood group) [ Homo sapiens (human) ]
Official Symbol SLC14A1
Synonyms JK; UT1; UTE; HUT11; Jk(a); Jk(b); RACH1; RACH2; UT-B1; HUT11A; HsT1341
Gene ID 6563
mRNA Refseq NM_015865.7
Protein Refseq NP_056949.4
MIM 613868
UniProt ID Q13336

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC14A1 Products

Required fields are marked with *

My Review for All SLC14A1 Products

Required fields are marked with *

0
cart-icon