Recombinant Full Length Human SLC16A2 Protein

Cat.No. : SLC16A2-6790HF
Product Overview : Recombinant full-length Human SLC16A2 Protein is produced by Wheat Germ (in vitro) expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 1033 amino acids
Description : This gene encodes an integral membrane protein transporter of thyroid hormone; specifically, cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues including brain, heart, placenta, lung, kidney, skeletal muscle, and liver. This gene likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation.
Form : Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 67.5 kDa
AA Sequence : MGRGGGGLDVGGGGEGSRDRLSRDGLASWGAEPGGGGSGSGSSSPPSSSSCSSRNKYQPQSGSSGPSSHSPPAAMALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC16A2 solute carrier family 16, member 2 (thyroid hormone transporter) [ Homo sapiens ]
Official Symbol SLC16A2
Synonyms SLC16A2; solute carrier family 16, member 2 (thyroid hormone transporter); MCT7; MCT8; XPCT; AHDS; MCT 7; MCT 8; MRX22; DXS128; DXS128E;
Gene ID 6567
mRNA Refseq NM_006517
Protein Refseq NP_006508
MIM 300095
UniProt ID P36021

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC16A2 Products

Required fields are marked with *

My Review for All SLC16A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon