Recombinant Full Length Human SLC18A2 Protein, C-Flag-tagged
Cat.No. : | SLC18A2-1559HFL |
Product Overview : | Recombinant Full Length Human SLC18A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an transmembrane protein that functions as an ATP-dependent transporter of monoamines, such as dopamine, norepinephrine, serotonin, and histamine. This protein transports amine neurotransmitters into synaptic vesicles. Polymorphisms in this gene may be associated with schizophrenia, bipolar disorder, and other neurological/psychiatric ailments. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTAS ISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT VQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASV YTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQ KGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGI LAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPI KTKMYTQNNIQSYPIGEDEESESDSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Parkinson's disease |
Full Length : | Full L. |
Gene Name | SLC18A2 solute carrier family 18 member A2 [ Homo sapiens (human) ] |
Official Symbol | SLC18A2 |
Synonyms | SVAT; SVMT; VAT2; VMAT2; PKDYS2 |
Gene ID | 6571 |
mRNA Refseq | NM_003054.6 |
Protein Refseq | NP_003045.2 |
MIM | 193001 |
UniProt ID | Q05940 |
◆ Recombinant Proteins | ||
SLC18A2-392H | Recombinant Human SLC18A2 | +Inquiry |
SLC18A2-16H | Recombinant Human SLC18A2 Protein, His-tagged | +Inquiry |
SLC18A2-5444R | Recombinant Rat SLC18A2 Protein | +Inquiry |
SLC18A2-3812H | Recombinant Human SLC18A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Slc18a2-5907M | Recombinant Mouse Slc18a2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC18A2 Products
Required fields are marked with *
My Review for All SLC18A2 Products
Required fields are marked with *