Recombinant Full Length Human SLC22A1 Protein, GST-tagged
Cat.No. : | SLC22A1-6823HF |
Product Overview : | Recombinant Human SLC22A1 Full-Length ORF Protein is produced by Wheat Germ (in vitro) expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 1049 amino acids |
Description : | Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter. |
Form : | Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 61 kDa |
AA Sequence : | MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFFFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT |
Applications : | Antibody Production |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC22A1 solute carrier family 22 (organic cation transporter), member 1 [ Homo sapiens ] |
Official Symbol | SLC22A1 |
Synonyms | SLC22A1; OCT1; HOCT1; oct1_cds; |
Gene ID | 6580 |
mRNA Refseq | NM_003057 |
Protein Refseq | NP_003048 |
MIM | 602607 |
UniProt ID | O15245 |
◆ Recombinant Proteins | ||
SLC22A1-677H | Recombinant Human SLC22A1 Protein | +Inquiry |
SLC22A1-8544H | Recombinant Human SLC22A1 protein, His-SUMO-tagged | +Inquiry |
SLC22A1-15261M | Recombinant Mouse SLC22A1 Protein | +Inquiry |
SLC22A1-5451R | Recombinant Rat SLC22A1 Protein | +Inquiry |
SLC22A1-8255M | Recombinant Mouse SLC22A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC22A1 Products
Required fields are marked with *
My Review for All SLC22A1 Products
Required fields are marked with *
0
Inquiry Basket