Recombinant Full Length Human SLC22A1 Protein, GST-tagged
| Cat.No. : | SLC22A1-6823HF |
| Product Overview : | Recombinant Human SLC22A1 Full-Length ORF Protein is produced by Wheat Germ (in vitro) expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 1049 amino acids |
| Description : | Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter. |
| Form : | Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 61 kDa |
| AA Sequence : | MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFFFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT |
| Applications : | Antibody Production |
| Notes : | Best use within three months from the date of receipt of this protein |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SLC22A1 solute carrier family 22 (organic cation transporter), member 1 [ Homo sapiens ] |
| Official Symbol | SLC22A1 |
| Synonyms | SLC22A1; OCT1; HOCT1; oct1_cds; |
| Gene ID | 6580 |
| mRNA Refseq | NM_003057 |
| Protein Refseq | NP_003048 |
| MIM | 602607 |
| UniProt ID | O15245 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A1 Products
Required fields are marked with *
My Review for All SLC22A1 Products
Required fields are marked with *
Recently Viewed
