Recombinant Full Length Human SMCO1 Protein, GST-tagged

• Cat.No.: SMCO1-3902HF
• Product Overview: Human C3orf43 full-length ORF (BAG53982.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 214 amino acids
• Description: SMCO1 (Single-Pass Membrane Protein With Coiled-Coil Domains 1) is a Protein Coding gene.
• Molecular Mass: 51 kDa
• AA Sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SMCO1 single-pass membrane protein with coiled-coil domains 1 [ Homo sapiens (human) ]
• Official Symbol: SMCO1
• Synonyms: SMCO1; single-pass membrane protein with coiled-coil domains 1; Single-Pass Membrane Protein With Coiled-Coil Domains 1; C3orf43; Single-Pass Membrane And Coiled-Coil Domain-Containing Protein 1; Chromosome 3 Open Reading Frame 43; single-pass membrane and coiled-coil domain-containing protein 1
• Gene ID: 255798
• mRNA Refseq: NM_001077657
• Protein Refseq: NP_001071125
• UniProt ID: Q147U7