Recombinant Full Length Human SMR3B Protein, C-Flag-tagged
| Cat.No. : | SMR3B-2158HFL |
| Product Overview : | Recombinant Full Length Human SMR3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable endopeptidase inhibitor activity. Predicted to be involved in cellular response to lipopolysaccharide; negative regulation of peptidase activity; and regulation of sensory perception of pain. Located in extracellular exosome. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 8 kDa |
| AA Sequence : | MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG IFPPPPPQP myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ] |
| Official Symbol | SMR3B |
| Synonyms | P-B; PBII; PRL3; PROL3; SMR1B |
| Gene ID | 10879 |
| mRNA Refseq | NM_006685.4 |
| Protein Refseq | NP_006676.1 |
| MIM | 611593 |
| UniProt ID | P02814 |
| ◆ Recombinant Proteins | ||
| SMR3B-2158HFL | Recombinant Full Length Human SMR3B Protein, C-Flag-tagged | +Inquiry |
| SMR3B-2048H | Recombinant Human SMR3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| SMR3B-3851H | Recombinant Human SMR3B protein, His-tagged | +Inquiry |
| SMR3B-2064H | Recombinant Human SMR3B Protein, MYC/DDK-tagged | +Inquiry |
| SMR3B-1100H | Recombinant Human SMR3B protein(Met1-Pro79), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMR3B-910HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
| SMR3B-001HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMR3B Products
Required fields are marked with *
My Review for All SMR3B Products
Required fields are marked with *
