Recombinant Full Length Human SNCA Protein, C-Flag-tagged
Cat.No. : | SNCA-326HFL |
Product Overview : | Recombinant Full Length Human SNCA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Alzheimer's disease, Parkinson's disease |
Full Length : | Full L. |
Gene Name | SNCA synuclein alpha [ Homo sapiens (human) ] |
Official Symbol | SNCA |
Synonyms | PD1; NACP; PARK1; PARK4 |
Gene ID | 6622 |
mRNA Refseq | NM_000345.4 |
Protein Refseq | NP_000336.1 |
MIM | 163890 |
UniProt ID | P37840 |
◆ Recombinant Proteins | ||
SNCA-112H | Recombinant Human SNCA Protein | +Inquiry |
SNCA-5523C | Recombinant Cynomolgus monkey SNCA protein, His-tagged | +Inquiry |
Snca-387R | Recombinant Rat Snca Protein | +Inquiry |
SNCA-166H | Recombinant Human SNCA protein, His-tagged | +Inquiry |
SNCA-76H | Recombinant Human SNCA, A30P Mutant | +Inquiry |
◆ Native Proteins | ||
SNCA-27342TH | Native Human SNCA | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *
0
Inquiry Basket