Recombinant Full Length Human SNRNP70 Protein, C-Flag-tagged
Cat.No. : | SNRNP70-1189HFL |
Product Overview : | Recombinant Full Length Human SNRNP70 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables U1 snRNA binding activity. Involved in mRNA splicing, via spliceosome and regulation of RNA splicing. Located in nucleoplasm. Part of U1 snRNP and spliceosomal complex. Implicated in disease of mental health and systemic lupus erythematosus. Biomarker of Alzheimer's disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK RREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS GKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRH SGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRER SKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR DRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG DGYLAPENGYLMEAAPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | SNRNP70 small nuclear ribonucleoprotein U1 subunit 70 [ Homo sapiens (human) ] |
Official Symbol | SNRNP70 |
Synonyms | RPU1; Snp1; U1AP; U170K; U1RNP; RNPU1Z; SNRP70; U1-70K |
Gene ID | 6625 |
mRNA Refseq | NM_003089.6 |
Protein Refseq | NP_003080.2 |
MIM | 180740 |
UniProt ID | P08621 |
◆ Recombinant Proteins | ||
SNRNP70-1162Z | Recombinant Zebrafish SNRNP70 | +Inquiry |
SNRNP70-227 | Recombinant Human SNRNP70, His-tagged | +Inquiry |
SNRNP70-1036H | Recombinant Human SNRNP70 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNRNP70-227H | Recombinant Human SNRNP70 protein | +Inquiry |
SNRNP70-2059H | Recombinant Full Length Human small nuclear ribonucleoprotein 70kDa (U1) Protein, His&Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRNP70-1620HCL | Recombinant Human SNRNP70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNRNP70 Products
Required fields are marked with *
My Review for All SNRNP70 Products
Required fields are marked with *
0
Inquiry Basket