| Species : | Human | 
                                
                                    | Source : | Mammalian Cells | 
                                
                                    | Tag : | Flag | 
                                
                                    | Description : | The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. | 
                                
                                    | Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                    | Molecular Mass : | 24.4 kDa | 
                                
                                    | AA Sequence : | MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG TPMGMPPPGMRPPPPGMRGPPPPGMRPPRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
 | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                    | Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Storage : | Store at -80 centigrade. | 
                                
                                    | Concentration : | >50 ug/mL as determined by microplate BCA method. | 
                                
                                    | Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                    | Protein Families : | Stem cell - Pluripotency | 
                                
                                    | Protein Pathways : | Spliceosome, Systemic lupus erythematosus | 
                                
                                    | Full Length : | Full L. |