Recombinant Human SNRPB Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNRPB-068H |
Product Overview : | SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNRPB small nuclear ribonucleoprotein polypeptides B and B1 [ Homo sapiens (human) ] |
Official Symbol | SNRPB |
Synonyms | SNRPB; small nuclear ribonucleoprotein polypeptides B and B1; CCMS; COD; Sm-B/B'; SmB/B'; SmB/SmB'; snRNP-B; SNRPB1; small nuclear ribonucleoprotein-associated proteins B and B'; B polypeptide of Sm protein; Sm protein B/B'; sm-B/Sm-B'; small nuclear ribonucleoprotein polypeptide B; small nuclear ribonucleoprotein polypeptides B and B' |
Gene ID | 6628 |
mRNA Refseq | NM_198216 |
Protein Refseq | NP_937859 |
MIM | 182282 |
UniProt ID | P14678 |
◆ Recombinant Proteins | ||
SNRPB-2061H | Recombinant Human SNRPB Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPB-068H | Recombinant Human SNRPB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Snrpb-6005M | Recombinant Mouse Snrpb Protein, Myc/DDK-tagged | +Inquiry |
SNRPB-11692Z | Recombinant Zebrafish SNRPB | +Inquiry |
SNRPB-4377R | Recombinant Rhesus monkey SNRPB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPB-1617HCL | Recombinant Human SNRPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPB Products
Required fields are marked with *
My Review for All SNRPB Products
Required fields are marked with *