Recombinant Full Length Human SOD3 Protein, C-Flag-tagged
Cat.No. : | SOD3-586HFL |
Product Overview : | Recombinant Full Length Human SOD3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.1 kDa |
AA Sequence : | MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSAT LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV GVCGPGLWERQAREHSERKKRRRESECKAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SOD3 superoxide dismutase 3 [ Homo sapiens (human) ] |
Official Symbol | SOD3 |
Synonyms | EC-SOD |
Gene ID | 6649 |
mRNA Refseq | NM_003102.4 |
Protein Refseq | NP_003093.2 |
MIM | 185490 |
UniProt ID | P08294 |
◆ Recombinant Proteins | ||
SOD3-3374M | Recombinant Mouse SOD3 protein, His-tagged | +Inquiry |
Sod3-16M | Recombinant Mouse Sod3 protein | +Inquiry |
SOD3-1038H | Recombinant Full Length Human SOD3 Protein, Tag Free | +Inquiry |
SOD3-15751M | Recombinant Mouse SOD3 Protein | +Inquiry |
SOD3-3182H | Recombinant Human SOD3 Protein (Trp19-Ala240), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD3-1573HCL | Recombinant Human SOD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOD3 Products
Required fields are marked with *
My Review for All SOD3 Products
Required fields are marked with *
0
Inquiry Basket