Recombinant Full Length Human SOX13 Protein, C-Flag-tagged
Cat.No. : | SOX13-1811HFL |
Product Overview : | Recombinant Full Length Human SOX13 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69 kDa |
AA Sequence : | MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFR GSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKG TQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQH KINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAM ATHHPLQEPSQPLNLTAKPKAPELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAV TKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRN SSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPD YKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVE HYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | SOX13 SRY-box transcription factor 13 [ Homo sapiens (human) ] |
Official Symbol | SOX13 |
Synonyms | ICA12; Sox-13 |
Gene ID | 9580 |
mRNA Refseq | NM_005686.3 |
Protein Refseq | NP_005677.2 |
MIM | 604748 |
UniProt ID | Q9UN79 |
◆ Recombinant Proteins | ||
SOX13-2073H | Recombinant Human SOX13 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX13-8586M | Recombinant Mouse SOX13 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX13-15775M | Recombinant Mouse SOX13 Protein | +Inquiry |
SOX13-2881H | Recombinant Human SOX13, GST-tagged | +Inquiry |
SOX13-138H | Recombinant Human SOX13 protein, Arginine-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX13-1563HCL | Recombinant Human SOX13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX13 Products
Required fields are marked with *
My Review for All SOX13 Products
Required fields are marked with *
0
Inquiry Basket