Recombinant Full Length Human SP2 Protein
Cat.No. : | SP2-489HF |
Product Overview : | Recombinant full length Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 53.46 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 249 amino acids |
Description : | This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. |
Form : | Liquid |
Molecular Mass : | 53.460kDa inclusive of tags |
AA Sequence : | MAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGP PAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGIL SSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAII TPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGG GNVTLTLPVNNLVNASDTGAPTQLLTASCQTGMLNSTRMF LFLAFINVL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SP2 Sp2 transcription factor [ Homo sapiens ] |
Official Symbol | SP2 |
Synonyms | SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048 |
Gene ID | 6668 |
mRNA Refseq | NM_003110 |
Protein Refseq | NP_003101 |
MIM | 601801 |
UniProt ID | Q02086 |
◆ Recombinant Proteins | ||
SP2-8596M | Recombinant Mouse SP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP2-31434TH | Recombinant Human SP2 | +Inquiry |
SP2-489HF | Recombinant Full Length Human SP2 Protein | +Inquiry |
SP2-15793M | Recombinant Mouse SP2 Protein | +Inquiry |
SP2-4234R | Recombinant Rhesus Macaque SP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SP2-1676HCL | Recombinant Human SP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SP2 Products
Required fields are marked with *
My Review for All SP2 Products
Required fields are marked with *
0
Inquiry Basket