Recombinant Full Length Human SP2 Protein

Cat.No. : SP2-489HF
Product Overview : Recombinant full length Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 53.46 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 249 amino acids
Description : This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
Form : Liquid
Molecular Mass : 53.460kDa inclusive of tags
AA Sequence : MAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGP PAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGIL SSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAII TPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGG GNVTLTLPVNNLVNASDTGAPTQLLTASCQTGMLNSTRMF LFLAFINVL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SP2 Sp2 transcription factor [ Homo sapiens ]
Official Symbol SP2
Synonyms SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048
Gene ID 6668
mRNA Refseq NM_003110
Protein Refseq NP_003101
MIM 601801
UniProt ID Q02086

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SP2 Products

Required fields are marked with *

My Review for All SP2 Products

Required fields are marked with *

0
cart-icon