Recombinant Full Length Human SP2 Protein
Cat.No. : | SP2-489HF |
Product Overview : | Recombinant full length Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 53.46 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 53.460kDa inclusive of tags |
Protein Length : | 249 amino acids |
AA Sequence : | MAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGP PAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGIL SSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAII TPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGG GNVTLTLPVNNLVNASDTGAPTQLLTASCQTGMLNSTRMF LFLAFINVL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SP2 Sp2 transcription factor [ Homo sapiens ] |
Official Symbol : | SP2 |
Synonyms : | SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048 |
Gene ID : | 6668 |
mRNA Refseq : | NM_003110 |
Protein Refseq : | NP_003101 |
MIM : | 601801 |
UniProt ID : | Q02086 |
Products Types
◆ Recombinant Protein | ||
SP2-4234R | Recombinant Rhesus Macaque SP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP2-8596M | Recombinant Mouse SP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP2-31434TH | Recombinant Human SP2 | +Inquiry |
SP2-5794Z | Recombinant Zebrafish SP2 | +Inquiry |
SP2-4418R | Recombinant Rhesus monkey SP2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
SP2-1676HCL | Recombinant Human SP2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket