Recombinant Full Length Human SPANXA1 Protein, C-Flag-tagged

Cat.No. : SPANXA1-1830HFL
Product Overview : Recombinant Full Length Human SPANXA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 10.9 kDa
AA Sequence : MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLND HARENRINPLQMEEEEFMEIMVEIPAK myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name SPANXA1 sperm protein associated with the nucleus, X-linked, family member A1 [ Homo sapiens (human) ]
Official Symbol SPANXA1
Synonyms NAP-X; SPANX; CT11.1; CT11.3; SPAN-X; SPAN-Xa; SPAN-Xb; SPANX-A
Gene ID 30014
mRNA Refseq NM_013453.3
Protein Refseq NP_038481.2
MIM 300305
UniProt ID Q9NS26

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPANXA1 Products

Required fields are marked with *

My Review for All SPANXA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon