Recombinant Full Length Human SPATA7 Protein, GST-tagged
Cat.No. : | SPATA7-3743HF |
Product Overview : | Human SPATA7 full-length ORF ( NP_001035518.1, 1 a.a. - 567 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 567 amino acids |
Description : | This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 90.6 kDa |
AA Sequence : | MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAAVDCSVPVSVSTSIKYADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPATA7 spermatogenesis associated 7 [ Homo sapiens (human) ] |
Official Symbol | SPATA7 |
Synonyms | HSD3; LCA3; HSD-3.1; HEL-S-296 |
Gene ID | 55812 |
mRNA Refseq | NM_001040428.1 |
Protein Refseq | NP_001035518.1 |
MIM | 609868 |
UniProt ID | Q9P0W8 |
◆ Recombinant Proteins | ||
SPATA7-8623M | Recombinant Mouse SPATA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spata7-269M | Recombinant Mouse Spata7 Protein, MYC/DDK-tagged | +Inquiry |
SPATA7-2303H | Recombinant Human SPATA7 Protein, MYC/DDK-tagged | +Inquiry |
SPATA7-709C | Recombinant Cynomolgus Monkey SPATA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPATA7-2607H | Recombinant Human SPATA7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA7-1531HCL | Recombinant Human SPATA7 293 Cell Lysate | +Inquiry |
SPATA7-1532HCL | Recombinant Human SPATA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPATA7 Products
Required fields are marked with *
My Review for All SPATA7 Products
Required fields are marked with *
0
Inquiry Basket