Recombinant Full Length Human Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged
| Cat.No. : | RFL1995HF |
| Product Overview : | Recombinant Full Length Human Sphingosine 1-phosphate receptor 1(S1PR1) Protein (P21453) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-382) |
| Form : | Lyophilized powder |
| AA Sequence : | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH PQKDEGDNPETIMSSGNVNSSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | S1PR1 |
| Synonyms | S1PR1; CHEDG1; EDG1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363 |
| UniProt ID | P21453 |
| ◆ Recombinant Proteins | ||
| S1PR1-28462TH | Recombinant Human S1PR1 protein | +Inquiry |
| RFL31955RF | Recombinant Full Length Rat Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged | +Inquiry |
| RFL15845DF | Recombinant Full Length Danio Rerio Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged | +Inquiry |
| S1PR1-4023H | Recombinant Human S1PR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| S1PR1-14628M | Recombinant Mouse S1PR1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S1PR1-530HCL | Recombinant Human S1PR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S1PR1 Products
Required fields are marked with *
My Review for All S1PR1 Products
Required fields are marked with *



