Recombinant Human S1PR1 protein
Cat.No. : | S1PR1-28462TH |
Product Overview : | Recombinant Human S1PR1(1 a.a. - 288 a.a.) was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 1-288 a.a. |
Description : | The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKK FHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMK LHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIY SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSS GNVNSSS |
Applications : | Antibody Production; Functional Study; Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | S1PR1 sphingosine-1-phosphate receptor 1 [ Homo sapiens ] |
Official Symbol | S1PR1 |
Synonyms | S1PR1; sphingosine-1-phosphate receptor 1; EDG1, endothelial differentiation, sphingolipid G protein coupled receptor, 1; sphingosine 1-phosphate receptor 1; CD363; D1S3362; edg 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-protein-coupled receptor, 1; EDG1; S1P1; ECGF1; EDG-1; CHEDG1; FLJ58121; |
Gene ID | 1901 |
mRNA Refseq | NM_001400 |
Protein Refseq | NP_001391 |
MIM | 601974 |
UniProt ID | P21453 |
Chromosome Location | 1p21 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Lysosphingolipid and LPA receptors, organism-specific biosystem; |
Function | G-protein coupled receptor activity; receptor activity; signal transducer activity; sphingolipid binding; sphingosine-1-phosphate receptor activity; |
◆ Recombinant Proteins | ||
S1PR1-4725HF | Recombinant Full Length Human S1PR1 Protein, GST-tagged | +Inquiry |
S1PR1-569H | Recombinant Human S1PR1 | +Inquiry |
S1pr1-2041M | Recombinant Mouse S1pr1 Protein, His-tagged | +Inquiry |
RFL15845DF | Recombinant Full Length Danio Rerio Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged | +Inquiry |
S1PR1-4023H | Recombinant Human S1PR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S1PR1-530HCL | Recombinant Human S1PR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S1PR1 Products
Required fields are marked with *
My Review for All S1PR1 Products
Required fields are marked with *
0
Inquiry Basket