Recombinant Human S1PR1 protein

Cat.No. : S1PR1-28462TH
Product Overview : Recombinant Human S1PR1(1 a.a. - 288 a.a.) was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 1-288 a.a.
Description : The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 42.8 kDa
AA Sequence : MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKK FHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMK LHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIY SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSS GNVNSSS
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein. Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name S1PR1 sphingosine-1-phosphate receptor 1 [ Homo sapiens ]
Official Symbol S1PR1
Synonyms S1PR1; sphingosine-1-phosphate receptor 1; EDG1, endothelial differentiation, sphingolipid G protein coupled receptor, 1; sphingosine 1-phosphate receptor 1; CD363; D1S3362; edg 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-protein-coupled receptor, 1; EDG1; S1P1; ECGF1; EDG-1; CHEDG1; FLJ58121;
Gene ID 1901
mRNA Refseq NM_001400
Protein Refseq NP_001391
MIM 601974
UniProt ID P21453
Chromosome Location 1p21
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Lysosphingolipid and LPA receptors, organism-specific biosystem;
Function G-protein coupled receptor activity; receptor activity; signal transducer activity; sphingolipid binding; sphingosine-1-phosphate receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S1PR1 Products

Required fields are marked with *

My Review for All S1PR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon