Recombinant Full Length Human SPHK2 Protein, C-Flag-tagged
Cat.No. : | SPHK2-1677HFL |
Product Overview : | Recombinant Full Length Human SPHK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of two sphingosine kinase isozymes that catalyze the phosphorylation of sphingosine into sphingosine 1-phosphate. Sphingosine 1-phosphate mediates many cellular processes including migration, proliferation and apoptosis, and also plays a role in several types of cancer by promoting angiogenesis and tumorigenesis. The encoded protein may play a role in breast cancer proliferation and chemoresistance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69 kDa |
AA Sequence : | MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPARGPRFALTLT SQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGARRRATRTFRADGA ATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISE AGLSFNLIQTERQNHARELVQGLSLSEWDGIVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGN ALAGAVNQHGGFEPALGLDLLLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERF RALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGA PVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHAR FDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGP LQAQMHPGIGTLLTGPPGCPGREPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Calcium signaling pathway, Fc gamma R-mediated phagocytosis, Metabolic pathways, Sphingolipid metabolism, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | SPHK2 sphingosine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | SPHK2 |
Synonyms | SK 2; SK-2; SPK 2; SPK-2 |
Gene ID | 56848 |
mRNA Refseq | NM_020126.5 |
Protein Refseq | NP_064511.2 |
MIM | 607092 |
UniProt ID | Q9NRA0 |
◆ Recombinant Proteins | ||
SPHK2-4250R | Recombinant Rhesus Macaque SPHK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPHK2-30668TH | Active Recombinant Human SPHK2, His-tagged | +Inquiry |
SPHK2-1677HFL | Recombinant Full Length Human SPHK2 Protein, C-Flag-tagged | +Inquiry |
SPHK2-525H | Recombinant Human Sphingosine Kinase 2, His-tagged | +Inquiry |
SPHK2-7105HF | Active Recombinant Full Length Human SPHK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPHK2-1682HCL | Recombinant Human SPHK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPHK2 Products
Required fields are marked with *
My Review for All SPHK2 Products
Required fields are marked with *
0
Inquiry Basket