Recombinant Full Length Human SPIN1 Protein, Flag tagged

Cat.No. : SPIN1-6236H
Product Overview : Recombinant Full Length Human SPIN1 Protein with Flag tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293T
Tag : Flag
Conjugation/Label : 1-262 aa
Description : Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (PubMed:24589551). Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes (PubMed:21960006). May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.
AASequence : MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVT QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS myc-FLAG tag
Molecular Mass : 29.4 kDa
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Note : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Concentration : >0.05 μg/μL as determined by microplate BCA method
Shipping : Dry Ice
Gene Name SPIN1 spindlin 1 [ Homo sapiens (human) ]
Official Symbol SPIN1
Synonyms SPIN1; spindlin 1; SPIN; TDRD24; spindlin-1; ovarian cancer-related protein; spindlin1
Gene ID 10927
mRNA Refseq NM_006717
Protein Refseq NP_006708
MIM 609936
UniProt ID Q9Y657

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPIN1 Products

Required fields are marked with *

My Review for All SPIN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon