| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    Mammalian Cells | 
                                
                                
                                    | Tag : | 
                                    Flag | 
                                
                                
                                    | Description : | 
                                    This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. | 
                                
                                
                                    | Form : | 
                                    25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                
                                    | Molecular Mass : | 
                                    27.9 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADL GAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLAR ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                
                                    | Purity : | 
                                    > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                
                                    | Stability : | 
                                    Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. | 
                                
                                
                                    | Concentration : | 
                                    >50 ug/mL as determined by microplate BCA method. | 
                                
                                
                                    | Preparation : | 
                                    Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                
                                    | Protein Families : | 
                                    Druggable Genome | 
                                
                                
                                    | Protein Pathways : | 
                                    Folate biosynthesis, Metabolic pathways | 
                                
                                
                                    | Full Length : | 
                                    Full L. |