Recombinant Full Length Human SPR Protein, C-Flag-tagged
Cat.No. : | SPR-1089HFL |
Product Overview : | Recombinant Full Length Human SPR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.9 kDa |
AA Sequence : | MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADL GAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLAR ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Folate biosynthesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | SPR sepiapterin reductase [ Homo sapiens (human) ] |
Official Symbol | SPR |
Synonyms | SDR38C1 |
Gene ID | 6697 |
mRNA Refseq | NM_003124.5 |
Protein Refseq | NP_003115.1 |
MIM | 182125 |
UniProt ID | P35270 |
◆ Recombinant Proteins | ||
Spr-6107M | Recombinant Mouse Spr Protein, Myc/DDK-tagged | +Inquiry |
SPR-2931H | Recombinant Human SPR, GST-tagged | +Inquiry |
SPR-4446R | Recombinant Rhesus monkey SPR Protein, His-tagged | +Inquiry |
Spr-205M | Recombinant Mouse Spr Protein, His-tagged | +Inquiry |
SPR-4262R | Recombinant Rhesus Macaque SPR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPR-1499HCL | Recombinant Human SPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPR Products
Required fields are marked with *
My Review for All SPR Products
Required fields are marked with *
0
Inquiry Basket