Recombinant Full Length Human SPRR1B Protein

Cat.No. : SPRR1B-492HF
Product Overview : Recombinant full length Human SPRR1b with N terminal proprietary tag; Predicted MWt 35.90 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 89 amino acids
Description : The protein encoded by this gene is an envelope protein of keratinocytes. The encoded protein is crosslinked to membrane proteins by transglutaminase, forming an insoluble layer under the plasma membrane. This protein is proline-rich and contains several tandem amino acid repeats.
Form : Liquid
Molecular Mass : 35.900kDa inclusive of tags
AA Sequence : MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SPRR1B small proline-rich protein 1B [ Homo sapiens ]
Official Symbol SPRR1B
Synonyms SPRR1B; small proline-rich protein 1B; SPRR1; cornifin-B; cornifin; GADD33
Gene ID 6699
mRNA Refseq NM_003125
Protein Refseq NP_003116
MIM 182266
UniProt ID P22528

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRR1B Products

Required fields are marked with *

My Review for All SPRR1B Products

Required fields are marked with *

0
cart-icon
0
compare icon