Recombinant Full Length Human SPRR1B Protein
Cat.No. : | SPRR1B-492HF |
Product Overview : | Recombinant full length Human SPRR1b with N terminal proprietary tag; Predicted MWt 35.90 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 89 amino acids |
Description : | The protein encoded by this gene is an envelope protein of keratinocytes. The encoded protein is crosslinked to membrane proteins by transglutaminase, forming an insoluble layer under the plasma membrane. This protein is proline-rich and contains several tandem amino acid repeats. |
Form : | Liquid |
Molecular Mass : | 35.900kDa inclusive of tags |
AA Sequence : | MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SPRR1B small proline-rich protein 1B [ Homo sapiens ] |
Official Symbol | SPRR1B |
Synonyms | SPRR1B; small proline-rich protein 1B; SPRR1; cornifin-B; cornifin; GADD33 |
Gene ID | 6699 |
mRNA Refseq | NM_003125 |
Protein Refseq | NP_003116 |
MIM | 182266 |
UniProt ID | P22528 |
◆ Recombinant Proteins | ||
SPRR1B-4266R | Recombinant Rhesus Macaque SPRR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR1B-4450R | Recombinant Rhesus monkey SPRR1B Protein, His-tagged | +Inquiry |
SPRR1B-492HF | Recombinant Full Length Human SPRR1B Protein | +Inquiry |
SPRR1B-15930M | Recombinant Mouse SPRR1B Protein | +Inquiry |
SPRR1B-2933H | Recombinant Human SPRR1B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRR1B-629HCL | Recombinant Human SPRR1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR1B Products
Required fields are marked with *
My Review for All SPRR1B Products
Required fields are marked with *