Recombinant Human SPRR1B
Cat.No. : | SPRR1B-30402TH |
Product Overview : | Recombinant full length Human SPRR1b with N terminal proprietary tag; Predicted MWt 35.90 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Molecular Weight : | 35.900kDa inclusive of tags |
Tissue specificity : | Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK |
Sequence Similarities : | Belongs to the cornifin (SPRR) family. |
Gene Name | SPRR1B small proline-rich protein 1B [ Homo sapiens ] |
Official Symbol | SPRR1B |
Synonyms | SPRR1B; small proline-rich protein 1B; SPRR1; cornifin-B; cornifin; GADD33; |
Gene ID | 6699 |
mRNA Refseq | NM_003125 |
Protein Refseq | NP_003116 |
MIM | 182266 |
Uniprot ID | P22528 |
Chromosome Location | 1q21-q22 |
Function | protein binding, bridging; structural molecule activity; |
◆ Recombinant Proteins | ||
SPRR1B-2933H | Recombinant Human SPRR1B, GST-tagged | +Inquiry |
SPRR1B-30402TH | Recombinant Human SPRR1B | +Inquiry |
SPRR1B-8679M | Recombinant Mouse SPRR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR1B-4450R | Recombinant Rhesus monkey SPRR1B Protein, His-tagged | +Inquiry |
SPRR1B-492HF | Recombinant Full Length Human SPRR1B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRR1B-629HCL | Recombinant Human SPRR1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR1B Products
Required fields are marked with *
My Review for All SPRR1B Products
Required fields are marked with *
0
Inquiry Basket