Recombinant Human SPRR1B

Cat.No. : SPRR1B-30402TH
Product Overview : Recombinant full length Human SPRR1b with N terminal proprietary tag; Predicted MWt 35.90 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Molecular Weight : 35.900kDa inclusive of tags
Tissue specificity : Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
Sequence Similarities : Belongs to the cornifin (SPRR) family.
Gene Name SPRR1B small proline-rich protein 1B [ Homo sapiens ]
Official Symbol SPRR1B
Synonyms SPRR1B; small proline-rich protein 1B; SPRR1; cornifin-B; cornifin; GADD33;
Gene ID 6699
mRNA Refseq NM_003125
Protein Refseq NP_003116
MIM 182266
Uniprot ID P22528
Chromosome Location 1q21-q22
Function protein binding, bridging; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRR1B Products

Required fields are marked with *

My Review for All SPRR1B Products

Required fields are marked with *

0
cart-icon
0
compare icon