Recombinant Full Length Human SPRY2 Protein, C-Flag-tagged
Cat.No. : | SPRY2-1714HFL |
Product Overview : | Recombinant Full Length Human SPRY2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.5 kDa |
AA Sequence : | MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA PRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSF SSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | SPRY2 sprouty RTK signaling antagonist 2 [ Homo sapiens (human) ] |
Official Symbol | SPRY2 |
Synonyms | IGAN3; hSPRY2 |
Gene ID | 10253 |
mRNA Refseq | NM_005842.4 |
Protein Refseq | NP_005833.1 |
MIM | 602466 |
UniProt ID | O43597 |
◆ Recombinant Proteins | ||
SPRY2-6444H | Recombinant Human SPRY2 protein, His&Myc-tagged | +Inquiry |
SPRY2-1797H | Recombinant Human SPRY2 protein, His & T7-tagged | +Inquiry |
SPRY2-1131Z | Recombinant Zebrafish SPRY2 | +Inquiry |
Spry2-1799R | Recombinant Rat Spry2 protein, His & T7-tagged | +Inquiry |
SPRY2-6363C | Recombinant Chicken SPRY2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRY2-1490HCL | Recombinant Human SPRY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRY2 Products
Required fields are marked with *
My Review for All SPRY2 Products
Required fields are marked with *
0
Inquiry Basket