Recombinant Full Length Human SPTSSB Protein, GST-tagged

Cat.No. : SPTSSB-3892HF
Product Overview : Human C3orf57 full-length ORF (BAG35080.1, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 76 amino acids
Description : Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
Molecular Mass : 34.76 kDa
AA Sequence : MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPTSSB serine palmitoyltransferase small subunit B [ Homo sapiens (human) ]
Official Symbol SPTSSB
Synonyms SPTSSB; serine palmitoyltransferase small subunit B; Serine Palmitoyltransferase Small Subunit B; Small Subunit Of Serine Palmitoyltransferase B; Androgen Down Regulated In Mouse Prostate; C3orf57; SSSPTB; ADMP; Likely Ortholog Of Androgen Down Regulated Gene Expressed In Mouse Prostate; Serine Palmitoyltransferase, Small Subunit B; Chromosome 3 Open Reading Frame 57; Protein ADMP; serine palmitoyltransferase small subunit B; androgen down regulated in mouse prostate; likely ortholog of androgen down regulated gene expressed in mouse prostate; small subunit of serine palmitoyltransferase B
Gene ID 165679
mRNA Refseq NM_001040100
Protein Refseq NP_001035189
MIM 610412
UniProt ID Q8NFR3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPTSSB Products

Required fields are marked with *

My Review for All SPTSSB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon