Recombinant Full Length Human SQOR Protein, C-Flag-tagged
Cat.No. : | SQOR-13HFL |
Product Overview : | Recombinant Full Length Human SQOR Protein, fused to Flag-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | The protein encoded by this gene may function in mitochondria to catalyze the conversion of sulfide to persulfides, thereby decreasing toxic concencrations of sulfide. Alternative splicing results in multiple transcript variants that encode the same protein. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAEN VAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRY LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDK PGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVA AQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 µg/µL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | SQOR sulfide quinone oxidoreductase [ Homo sapiens (human) ] |
Official Symbol | SQOR |
Synonyms | SQR; SQRDL; CGI-44; PRO1975 |
Gene ID | 58472 |
mRNA Refseq | NM_021199.4 |
Protein Refseq | NP_067022.1 |
MIM | 617658 |
UniProt ID | Q9Y6N5 |
◆ Recombinant Proteins | ||
SQOR-3268H | Recombinant Human SQOR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sqor-6119M | Recombinant Mouse Sqor Protein, Myc/DDK-tagged | +Inquiry |
SQOR-13HFL | Recombinant Full Length Human SQOR Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SQOR Products
Required fields are marked with *
My Review for All SQOR Products
Required fields are marked with *
0
Inquiry Basket