Recombinant Full Length Human SSPN Protein, C-Flag-tagged
Cat.No. : | SSPN-970HFL |
Product Overview : | Recombinant Full Length Human SSPN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL LACFVMWKHRYQVFYVGVRICSLTASEGPQQKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | SSPN sarcospan [ Homo sapiens (human) ] |
Official Symbol | SSPN |
Synonyms | KRAG; NSPN; SPN1; SPN2; DAGA5 |
Gene ID | 8082 |
mRNA Refseq | NM_005086.5 |
Protein Refseq | NP_005077.2 |
MIM | 601599 |
UniProt ID | Q14714 |
◆ Recombinant Proteins | ||
SSPN-5704H | Recombinant Human SSPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL2468HF | Recombinant Full Length Human Sarcospan(Sspn) Protein, His-Tagged | +Inquiry |
RFL13337MF | Recombinant Full Length Mouse Sarcospan(Sspn) Protein, His-Tagged | +Inquiry |
Sspn-1282M | Recombinant Mouse Sspn Protein, MYC/DDK-tagged | +Inquiry |
SSPN-4304R | Recombinant Rhesus Macaque SSPN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSPN-1697HCL | Recombinant Human SSPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSPN Products
Required fields are marked with *
My Review for All SSPN Products
Required fields are marked with *
0
Inquiry Basket