Recombinant Full Length Human STAM Protein, C-Flag-tagged
Cat.No. : | STAM-1315HFL |
Product Overview : | Recombinant Full Length Human STAM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59 kDa |
AA Sequence : | MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Endocytosis, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | STAM signal transducing adaptor molecule [ Homo sapiens (human) ] |
Official Symbol | STAM |
Synonyms | STAM1; STAM-1 |
Gene ID | 8027 |
mRNA Refseq | NM_003473.4 |
Protein Refseq | NP_003464.1 |
MIM | 601899 |
UniProt ID | Q92783 |
◆ Recombinant Proteins | ||
STAM-1307H | Recombinant Human STAM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STAM-2850H | Recombinant Human STAM Protein, MYC/DDK-tagged | +Inquiry |
STAM-6606H | Recombinant Human STAM Protein (Thr196-Pro391), N-His tagged | +Inquiry |
Stam-7147M | Recombinant Mouse Stam protein, His & T7-tagged | +Inquiry |
STAM-1315HFL | Recombinant Full Length Human STAM Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAM-636HCL | Recombinant Human STAM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAM Products
Required fields are marked with *
My Review for All STAM Products
Required fields are marked with *
0
Inquiry Basket