Recombinant Full Length Human STAR Protein

Cat.No. : STAR-504HF
Product Overview : Recombinant full length Human StAR with N terminal proprietary tag, 57.46kDa inclusive of tag. Purified from an in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 286 amino acids
Description : The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
Form : Liquid
Molecular Mass : 57.460kDa inclusive of tags
AA Sequence : MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRAL GGPTPSTWINQVRRRSSLLGSRLEETLYSDQELAYLQQGE EAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKI GKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLA GMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA SEARC
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name STAR steroidogenic acute regulatory protein [ Homo sapiens ]
Official Symbol STAR
Synonyms STAR; steroidogenic acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein, mitochondrial; StAR; StAR related lipid transfer (START) domain containing 1; STARD1
Gene ID 6770
mRNA Refseq NM_000349
Protein Refseq NP_000340
MIM 600617
UniProt ID P49675

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAR Products

Required fields are marked with *

My Review for All STAR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon