Recombinant Full Length Human STAR Protein
Cat.No. : | STAR-504HF |
Product Overview : | Recombinant full length Human StAR with N terminal proprietary tag, 57.46kDa inclusive of tag. Purified from an in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 57.460kDa inclusive of tags |
Protein Length : | 286 amino acids |
AA Sequence : | MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRAL GGPTPSTWINQVRRRSSLLGSRLEETLYSDQELAYLQQGE EAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKI GKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLA GMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA SEARC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | STAR steroidogenic acute regulatory protein [ Homo sapiens ] |
Official Symbol : | STAR |
Synonyms : | STAR; steroidogenic acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein, mitochondrial; StAR; StAR related lipid transfer (START) domain containing 1; STARD1 |
Gene ID : | 6770 |
mRNA Refseq : | NM_000349 |
Protein Refseq : | NP_000340 |
MIM : | 600617 |
UniProt ID : | P49675 |
Products Types
◆ Recombinant Protein | ||
STAR-2903H | Recombinant Human STAR Protein, MYC/DDK-tagged | +Inquiry |
STAR-5436R | Recombinant Rat STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
Star-6162M | Recombinant Mouse Star Protein, Myc/DDK-tagged | +Inquiry |
STAR-507H | Recombinant Human STAR Protein, His/GST-tagged | +Inquiry |
STAR-2113H | Recombinant Human STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
STAR-637HCL | Recombinant Human STAR lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket