Recombinant Full Length Human STARD10 Protein, C-Flag-tagged
Cat.No. : | STARD10-2113HFL |
Product Overview : | Recombinant Full Length Human STARD10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable lipid binding activity. Predicted to be involved in lipid transport. Predicted to act upstream of or within bile acid secretion and positive regulation of peroxisome proliferator activated receptor signaling pathway. Located in cytosol. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.9 kDa |
AA Sequence : | MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKC RMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMG ADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPK AMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAG GEGSDDDTSLT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | STARD10 StAR related lipid transfer domain containing 10 [ Homo sapiens (human) ] |
Official Symbol | STARD10 |
Synonyms | PCTP2; CGI-52; NY-CO-28; SDCCAG28 |
Gene ID | 10809 |
mRNA Refseq | NM_006645.3 |
Protein Refseq | NP_006636.2 |
MIM | 617382 |
UniProt ID | Q9Y365 |
◆ Recombinant Proteins | ||
STARD10-2991H | Recombinant Human STARD10 protein, His-tagged | +Inquiry |
Stard10-6163M | Recombinant Mouse Stard10 Protein, Myc/DDK-tagged | +Inquiry |
STARD10-2114H | Recombinant Human STARD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
STARD10-2113HFL | Recombinant Full Length Human STARD10 Protein, C-Flag-tagged | +Inquiry |
STARD10-10560Z | Recombinant Zebrafish STARD10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STARD10-1423HCL | Recombinant Human STARD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STARD10 Products
Required fields are marked with *
My Review for All STARD10 Products
Required fields are marked with *