Recombinant Human STARD10 protein, GST-tagged
| Cat.No. : | STARD10-6754H |
| Product Overview : | Recombinant Human STARD10 protein(1-291 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-291 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | STARD10 |
| Synonyms | PCTP2; CGI-52; NY-CO-28; SDCCAG28 |
| Gene ID | 10809 |
| mRNA Refseq | NM_006645.2 |
| Protein Refseq | NP_006636.2 |
| UniProt ID | Q9Y365 |
| ◆ Recombinant Proteins | ||
| STARD10-2991H | Recombinant Human STARD10 protein, His-tagged | +Inquiry |
| Stard10-6163M | Recombinant Mouse Stard10 Protein, Myc/DDK-tagged | +Inquiry |
| STARD10-6754H | Recombinant Human STARD10 protein, GST-tagged | +Inquiry |
| STARD10-2114H | Recombinant Human STARD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STARD10-2113HFL | Recombinant Full Length Human STARD10 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STARD10-1423HCL | Recombinant Human STARD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STARD10 Products
Required fields are marked with *
My Review for All STARD10 Products
Required fields are marked with *
