Recombinant Full Length Human STAT6 Protein, C-Flag-tagged
Cat.No. : | STAT6-888HFL |
Product Overview : | Recombinant Full Length Human STAT6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 94 kDa |
AA Sequence : | MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLTSALLSDTVQHLQASVG EQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQ HRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQ QQLAGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVE KQPPQVLKTQTKFQAGVRFLLGLRFLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTV PLENSIPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIV HGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFN DNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLL NEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPK DEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVP QVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDP LLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSH YGQSGISMSHMDLRANLSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Protein Pathways : | Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | STAT6 signal transducer and activator of transcription 6 [ Homo sapiens (human) ] |
Official Symbol | STAT6 |
Synonyms | STAT6B; STAT6C; D12S1644; IL-4-STAT |
Gene ID | 6778 |
mRNA Refseq | NM_003153.5 |
Protein Refseq | NP_003144.3 |
MIM | 601512 |
UniProt ID | P42226 |
◆ Recombinant Proteins | ||
STAT6-344H | Recombinant Human STAT6 protein, His/MBP-tagged | +Inquiry |
Stat6-4312R | Recombinant Rat Stat6 Protein (Gly557-Trp841), N-His tagged | +Inquiry |
STAT6-888HFL | Recombinant Full Length Human STAT6 Protein, C-Flag-tagged | +Inquiry |
STAT6-6368H | Recombinant Human STAT6 Protein (Ser627-Ser837), C-His tagged | +Inquiry |
STAT6-151H | Recombinant Human STAT6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT6-481HCL | Recombinant Human STAT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT6 Products
Required fields are marked with *
My Review for All STAT6 Products
Required fields are marked with *
0
Inquiry Basket