Recombinant Full Length Human STEAP1 Protein, C-Flag-tagged
Cat.No. : | STEAP1-399HFL |
Product Overview : | Recombinant Full Length Human STEAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | STEAP1 STEAP family member 1 [ Homo sapiens (human) ] |
Official Symbol | STEAP1 |
Synonyms | STEAP; PRSS24 |
Gene ID | 26872 |
mRNA Refseq | NM_012449.3 |
Protein Refseq | NP_036581.1 |
MIM | 604415 |
UniProt ID | Q9UHE8 |
◆ Recombinant Proteins | ||
RFL24698MF | Recombinant Full Length Mouse Metalloreductase Steap1(Steap1) Protein, His-Tagged | +Inquiry |
STEAP1-2899H | Recombinant Human STEAP1 Protein, MYC/DDK-tagged | +Inquiry |
RFL9628SF | Recombinant Full Length Pig Metalloreductase Steap1(Steap1) Protein, His-Tagged | +Inquiry |
STEAP1-2120H | Recombinant Human STEAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STEAP1-399HFL | Recombinant Full Length Human STEAP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STEAP1 Products
Required fields are marked with *
My Review for All STEAP1 Products
Required fields are marked with *
0
Inquiry Basket