Recombinant Full Length Human Sterol-4-Alpha-Carboxylate 3-Dehydrogenase, Decarboxylating(Nsdhl) Protein, His-Tagged
Cat.No. : | RFL3668HF |
Product Overview : | Recombinant Full Length Human Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating(NSDHL) Protein (Q15738) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLAR GYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRV NYIGTKNVIETCKEAGVQKLILTSSASVIFEGVDIKNGTEDLPYAMKPIDYYTETKILQE RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFV ENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWVA YYLALLLSLLVMVISPVIQLQPTFTPMRVALAGTFHYYSCERAKKAMGYQPLVTMDDAME RTVQSFRHLRRVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NSDHL |
Synonyms | NSDHL; H105E3; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; Protein H105e3 |
UniProt ID | Q15738 |
◆ Recombinant Proteins | ||
NSDHL-2927R | Recombinant Rhesus Macaque NSDHL Protein, His (Fc)-Avi-tagged | +Inquiry |
NSDHL-2460H | Recombinant human NSDHL, His-tagged | +Inquiry |
RFL10622MF | Recombinant Full Length Mouse Sterol-4-Alpha-Carboxylate 3-Dehydrogenase, Decarboxylating(Nsdhl) Protein, His-Tagged | +Inquiry |
NSDHL-3515H | Recombinant Human NSDHL protein, His-tagged | +Inquiry |
NSDHL-2434Z | Recombinant Zebrafish NSDHL | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSDHL-1223HCL | Recombinant Human NSDHL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSDHL Products
Required fields are marked with *
My Review for All NSDHL Products
Required fields are marked with *