Recombinant Full Length Human STMND1 Protein, GST-tagged
| Cat.No. : | STMND1-4960HF |
| Product Overview : | Human FLJ23152 full-length ORF (1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 111 amino acids |
| Description : | STMND1 (Stathmin Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include tubulin binding. |
| Molecular Mass : | 39 kDa |
| AA Sequence : | MKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | STMND1 stathmin domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | STMND1 |
| Synonyms | STMND1; stathmin domain containing 1; stathmin domain-containing protein 1 |
| Gene ID | 401236 |
| mRNA Refseq | NM_001190766 |
| Protein Refseq | NP_001177695 |
| UniProt ID | H3BQB6 |
| ◆ Recombinant Proteins | ||
| STMND1-4282H | Recombinant Human STMND1 Protein, GST-tagged | +Inquiry |
| STMND1-4960HF | Recombinant Full Length Human STMND1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STMND1 Products
Required fields are marked with *
My Review for All STMND1 Products
Required fields are marked with *




