Recombinant Full Length Human STRAP Protein, C-Flag-tagged
Cat.No. : | STRAP-1259HFL |
Product Overview : | Recombinant Full Length Human STRAP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA binding activity. Involved in maintenance of gastrointestinal epithelium; negative regulation of transforming growth factor beta receptor signaling pathway; and spliceosomal snRNP assembly. Located in cytosol. Part of SMN complex. Implicated in adenocarcinoma; colorectal carcinoma; large cell carcinoma; lung carcinoma; and squamous cell neoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKD ATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEIS GHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHS AVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELY ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | STRAP serine/threonine kinase receptor associated protein [ Homo sapiens (human) ] |
Official Symbol | STRAP |
Synonyms | MAWD; PT-WD; UNRIP |
Gene ID | 11171 |
mRNA Refseq | NM_007178.4 |
Protein Refseq | NP_009109.3 |
MIM | 605986 |
UniProt ID | Q9Y3F4 |
◆ Recombinant Proteins | ||
STRAP-4970H | Recombinant Human STRAP protein, GST-tagged | +Inquiry |
STRAP-1394C | Recombinant Chicken STRAP | +Inquiry |
STRAP-4171H | Recombinant Human STRAP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STRAP-5805R | Recombinant Rat STRAP Protein | +Inquiry |
STRAP-31671TH | Recombinant Human STRAP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STRAP-642HCL | Recombinant Human STRAP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STRAP Products
Required fields are marked with *
My Review for All STRAP Products
Required fields are marked with *
0
Inquiry Basket