Recombinant Full Length Human STX2 Protein
Cat.No. : | STX2-512HF |
Product Overview : | Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 287 amino acids |
Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | Liquid |
Molecular Mass : | 57.640kDa inclusive of tags |
AA Sequence : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | STX2 syntaxin 2 [ Homo sapiens ] |
Official Symbol | STX2 |
Synonyms | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM |
Gene ID | 2054 |
mRNA Refseq | NM_001980 |
Protein Refseq | NP_001971 |
MIM | 132350 |
UniProt ID | P32856 |
◆ Recombinant Proteins | ||
STX2-4748HF | Recombinant Full Length Human STX2 Protein, GST-tagged | +Inquiry |
STX2-5749H | Recombinant Human STX2 Protein (Met1-Arg188), N-His tagged | +Inquiry |
STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry |
Stx2-961M | Recombinant Mouse Stx2 Protein, MYC/DDK-tagged | +Inquiry |
Stx2-411M | Active Recombinant Mouse Syntaxin 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *