Recombinant Full Length Human STX2 Protein
| Cat.No. : | STX2-512HF | 
| Product Overview : | Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 287 amino acids | 
| Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. | 
| Form : | Liquid | 
| Molecular Mass : | 57.640kDa inclusive of tags | 
| AA Sequence : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | STX2 syntaxin 2 [ Homo sapiens ] | 
| Official Symbol | STX2 | 
| Synonyms | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM | 
| Gene ID | 2054 | 
| mRNA Refseq | NM_001980 | 
| Protein Refseq | NP_001971 | 
| MIM | 132350 | 
| UniProt ID | P32856 | 
| ◆ Recombinant Proteins | ||
| STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry | 
| STX2-5472R | Recombinant Rat STX2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| STX2-6854H | Recombinant Human Syntaxin 2, His-tagged | +Inquiry | 
| STX2-512HF | Recombinant Full Length Human STX2 Protein | +Inquiry | 
| STX2-1546H | Recombinant Human STX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *
  
        
    
      
            