Recombinant Full Length Human STYXL1 Protein, GST-tagged
Cat.No. : | STYXL1-4750HF |
Product Overview : | Human DUSP24 full-length ORF ( AAH24035, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 313 amino acids |
Description : | STYXL1 (Serine/Threonine/Tyrosine Interacting Like 1) is a Protein Coding gene. GO annotations related to this gene include protein tyrosine/serine/threonine phosphatase activity. |
Molecular Mass : | 59.95 kDa |
AA Sequence : | MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | STYXL1 serine/threonine/tyrosine interacting-like 1 [ Homo sapiens ] |
Official Symbol | STYXL1 |
Synonyms | STYXL1; serine/threonine/tyrosine interacting-like 1; dual specificity phosphatase 24 (putative) , DUSP24; serine/threonine/tyrosine-interacting-like protein 1; MK STYX; dual specificity protein phosphatase 24; dual specificity phosphatase 24 (putative); map kinase phosphatase-like protein MK-STYX; dual specificity phosphatase inhibitor MK-STYX; DUSP24; MK-STYX; |
Gene ID | 51657 |
mRNA Refseq | NM_016086 |
Protein Refseq | NP_057170 |
MIM | 616695 |
UniProt ID | Q9Y6J8 |
◆ Recombinant Proteins | ||
STYXL1-4047H | Recombinant Human STYXL1 Protein, GST-tagged | +Inquiry |
STYXL1-4750HF | Recombinant Full Length Human STYXL1 Protein, GST-tagged | +Inquiry |
STYXL1-1338Z | Recombinant Zebrafish STYXL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STYXL1-1369HCL | Recombinant Human STYXL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STYXL1 Products
Required fields are marked with *
My Review for All STYXL1 Products
Required fields are marked with *