Recombinant Full Length Human STYXL1 Protein, GST-tagged

Cat.No. : STYXL1-4750HF
Product Overview : Human DUSP24 full-length ORF ( AAH24035, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 313 amino acids
Description : STYXL1 (Serine/Threonine/Tyrosine Interacting Like 1) is a Protein Coding gene. GO annotations related to this gene include protein tyrosine/serine/threonine phosphatase activity.
Molecular Mass : 59.95 kDa
AA Sequence : MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name STYXL1 serine/threonine/tyrosine interacting-like 1 [ Homo sapiens ]
Official Symbol STYXL1
Synonyms STYXL1; serine/threonine/tyrosine interacting-like 1; dual specificity phosphatase 24 (putative) , DUSP24; serine/threonine/tyrosine-interacting-like protein 1; MK STYX; dual specificity protein phosphatase 24; dual specificity phosphatase 24 (putative); map kinase phosphatase-like protein MK-STYX; dual specificity phosphatase inhibitor MK-STYX; DUSP24; MK-STYX;
Gene ID 51657
mRNA Refseq NM_016086
Protein Refseq NP_057170
MIM 616695
UniProt ID Q9Y6J8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STYXL1 Products

Required fields are marked with *

My Review for All STYXL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon