Recombinant Full Length Human SUB1 Protein, C-Flag-tagged

Cat.No. : SUB1-2181HFL
Product Overview : Recombinant Full Length Human SUB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables identical protein binding activity; single-stranded DNA binding activity; and transcription coactivator activity. Involved in negative regulation of DNA metabolic process and regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of transcription regulator complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 14.2 kDa
AA Sequence : MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transcription Factors
Full Length : Full L.
Gene Name SUB1 SUB1 regulator of transcription [ Homo sapiens (human) ]
Official Symbol SUB1
Synonyms P15; PC4; p14
Gene ID 10923
mRNA Refseq NM_006713.4
Protein Refseq NP_006704.3
MIM 600503
UniProt ID P53999

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUB1 Products

Required fields are marked with *

My Review for All SUB1 Products

Required fields are marked with *

0
cart-icon