Recombinant Full Length Human SUB1 Protein, C-Flag-tagged
Cat.No. : | SUB1-2181HFL |
Product Overview : | Recombinant Full Length Human SUB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity; single-stranded DNA binding activity; and transcription coactivator activity. Involved in negative regulation of DNA metabolic process and regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of transcription regulator complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | SUB1 SUB1 regulator of transcription [ Homo sapiens (human) ] |
Official Symbol | SUB1 |
Synonyms | P15; PC4; p14 |
Gene ID | 10923 |
mRNA Refseq | NM_006713.4 |
Protein Refseq | NP_006704.3 |
MIM | 600503 |
UniProt ID | P53999 |
◆ Recombinant Proteins | ||
SUB1-31457TH | Recombinant Human SUB1 | +Inquiry |
SUB1-2499H | Recombinant Human SUB1 Homolog(S. cerevisiae), His-tagged | +Inquiry |
SUB1-3541H | Recombinant Human SUB1 protein, His-SUMO-tagged | +Inquiry |
SUB1-1080H | Active Recombinant Human SUB1 Homolog(S. cerevisiae) | +Inquiry |
SUB1-3417H | Recombinant Human SUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUB1-1368HCL | Recombinant Human SUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUB1 Products
Required fields are marked with *
My Review for All SUB1 Products
Required fields are marked with *
0
Inquiry Basket